PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG493900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 329aa    MW: 35763.2 Da    PI: 4.3472
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG493900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-2075128356
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          k++++t+eq++ Le+ Fe+++++  e+++eLA+klgL+ rqV vWFqNrRa++k
  Pavir.1KG493900.1.p  75 KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWK 128
                          5678*************************************************9 PP

2HD-ZIP_I/II131.24e-4274166193
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekkrrl+ eqv+lLE+sFeee+kLeperK+elar+LglqprqvavWFqnrRAR+ktkqlE+d+++Lk+++dal+++++ L +++++Lr++
  Pavir.1KG493900.1.p  74 EKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLERDFDRLKASFDALRADHDLLLQDNHRLRSQ 163
                          69**************************************************************************************99 PP

          HD-ZIP_I/II  91 lke 93 
                          +++
  Pavir.1KG493900.1.p 164 VAS 166
                          975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.37E-2068132IPR009057Homeodomain-like
PROSITE profilePS5007118.2270130IPR001356Homeobox domain
SMARTSM003892.0E-2073134IPR001356Homeobox domain
CDDcd000861.27E-2075131No hitNo description
PfamPF000467.4E-1875128IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.3E-2276137IPR009057Homeodomain-like
PRINTSPR000312.1E-6101110IPR000047Helix-turn-helix motif
PROSITE patternPS000270105128IPR017970Homeobox, conserved site
PRINTSPR000312.1E-6110126IPR000047Helix-turn-helix motif
PfamPF021834.9E-17130172IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MESSRLIFSA TGSGAGQMFF LDCGAGGVPG GGGLFHRGGR PVLGLEEGRG VKRPFFTSPD  60
ELLEEEYYDE QLPEKKRRLT PEQVHLLERS FEEENKLEPE RKTELARKLG LQPRQVAVWF  120
QNRRARWKTK QLERDFDRLK ASFDALRADH DLLLQDNHRL RSQVASLTEK LQEKEGTEGG  180
ASADADAAAL PVDVKLASLA DEDVDEPPAE AFEAHQQVKS EDRLSTGSGG SAVVDTDALL  240
CGQLAAAVDS SVESYFPGGE DYHDCGMGGP VNHCPGGIQS DDDGAGSDEG CSYYPEDEAA  300
AAVFFAGHGH PHAEDDEDAG QIGWWMWN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122130RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.69860.0callus| leaf| root| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0652670.0BT065267.1 Zea mays full-length cDNA clone ZM_BFb0074N09 mRNA, complete cds.
GenBankBT0653520.0BT065352.1 Zea mays full-length cDNA clone ZM_BFb0114N22 mRNA, complete cds.
GenBankBT0865860.0BT086586.1 Zea mays full-length cDNA clone ZM_BFc0188G07 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953793.11e-163PREDICTED: homeobox-leucine zipper protein HOX16-like isoform X1
SwissprotQ6YWR41e-138HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16
TrEMBLC0PAE81e-164C0PAE8_MAIZE; Uncharacterized protein
STRINGSi017789m1e-162(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-67homeobox 1